Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
Domain d1ggua2: 1ggu A:516-627 [22179] Other proteins in same PDB: d1ggua1, d1ggua4, d1ggub1, d1ggub4 complexed with ca |
PDB Entry: 1ggu (more details), 2.1 Å
SCOPe Domain Sequences for d1ggua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggua2 b.1.5.1 (A:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1ggua2:
View in 3D Domains from other chains: (mouse over for more information) d1ggub1, d1ggub2, d1ggub3, d1ggub4 |