![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57212] (11 PDB entries) |
![]() | Domain d4fm5b1: 4fm5 B:32-72 [221277] Other proteins in same PDB: d4fm5a2, d4fm5b2, d4fm5c2, d4fm5d2 automated match to d1pxxa2 complexed with bog, df0, hem |
PDB Entry: 4fm5 (more details), 2.81 Å
SCOPe Domain Sequences for d4fm5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fm5b1 g.3.11.1 (B:32-72) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d4fm5b1: