Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (27 species) not a true protein |
Species Neisseria polysaccharea [TaxId:489] [226281] (5 PDB entries) |
Domain d4flsa2: 4fls A:555-628 [221274] Other proteins in same PDB: d4flsa1 automated match to d1g5aa1 complexed with cl, gol, suc; mutant |
PDB Entry: 4fls (more details), 2.3 Å
SCOPe Domain Sequences for d4flsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4flsa2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd ltlqpyqvmwleia
Timeline for d4flsa2: