Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [226397] (2 PDB entries) |
Domain d4fk8b2: 4fk8 B:116-271 [221247] Other proteins in same PDB: d4fk8a1, d4fk8b1 automated match to d1a8pa2 complexed with fad |
PDB Entry: 4fk8 (more details), 2.1 Å
SCOPe Domain Sequences for d4fk8b2:
Sequence, based on SEQRES records: (download)
>d4fk8b2 c.25.1.0 (B:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]} adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl pgheylgdvireklvyyptvtreefenegritdliasgklftdldmppfspeqdrvmlcg stamlkdttellkkaglvegknsapghyvierafvd
>d4fk8b2 c.25.1.0 (B:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]} adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl pgheylgdvireklvyyptvritdliasgklftdldmppfspeqdrvmlcgstamlkdtt ellkkaglvegknsapghyvierafvd
Timeline for d4fk8b2: