SCOPe 2.07: Domain d4ffba1: 4ffb A:1-246

Lineage for d4ffba1 (4ffb A:1-246)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.0: automated matches [227136] (1 protein)
   not a true family

6. Protein automated matches [226838] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224885] (2 PDB entries)

8. Domain d4ffba1: 4ffb A:1-246 [221161]
   Other proteins in same PDB: d4ffba2, d4ffbb2
   automated match to d1jffa1
   complexed with gtp, mg

Details for d4ffba1

PDB Entry: 4ffb, 2.88 Å

PDB Description: A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a Microtubule Polymerase

PDB Compounds: (A:) Tubulin alpha-1 chain

SCOPe Domain Sequences for d4ffba1:

Sequence; same for both SEQRES and ATOM records:

>d4ffba1 c.32.1.0 (A:1-246) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg
kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl
drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst
svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt
aslrfd

Timeline for d4ffba1:

• d4ffba1 first appeared in SCOPe 2.03
  
• d4ffba1 appears in SCOPe 2.06
  
• d4ffba1 appears in the current release, SCOPe 2.08