SCOPe 2.08: Domain d4f57l1: 4f57 L:1-108

Lineage for d4f57l1 (4f57 L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4f57l1: 4f57 L:1-108 [221026]
   Other proteins in same PDB: d4f57h_, d4f57l2
   automated match to d1q1jl1
   complexed with gol

Details for d4f57l1

PDB Entry: 4f57, 1.7 Å

PDB Description: Fab structure of a neutralizing antibody L1 from an early subtype A HIV-1 infected patient

PDB Compounds: (L:) Light chain of Fab of a neutralizing antibody L1

SCOPe Domain Sequences for d4f57l1:

Sequence; same for both SEQRES and ATOM records:

>d4f57l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgtssdvggynyvswyrqhpgeapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrq

Timeline for d4f57l1:

• d4f57l1 first appeared in SCOPe 2.03
  
• d4f57l1 appears in SCOPe 2.07