![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (25 PDB entries) Uniprot P00722 |
![]() | Domain d1dp0b2: 1dp0 B:626-730 [22076] Other proteins in same PDB: d1dp0a3, d1dp0a4, d1dp0a5, d1dp0b3, d1dp0b4, d1dp0b5, d1dp0c3, d1dp0c4, d1dp0c5, d1dp0d3, d1dp0d4, d1dp0d5 |
PDB Entry: 1dp0 (more details), 1.7 Å
SCOP Domain Sequences for d1dp0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp0b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1dp0b2:
![]() Domains from same chain: (mouse over for more information) d1dp0b1, d1dp0b3, d1dp0b4, d1dp0b5 |