SCOPe 2.04: Domain d4enwc2: 4enw C:598-753

Lineage for d4enwc2 (4enw C:598-753)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries)

8. Domain d4enwc2: 4enw C:598-753 [220750]
   Other proteins in same PDB: d4enwa1, d4enwb1, d4enwc1, d4enwd1
   automated match to d1p80a1
   complexed with hdd

Details for d4enwc2

PDB Entry: 4enw, 1.9 Å

PDB Description: Structure of the S234N variant of E. coli KatE

PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d4enwc2:

Sequence; same for both SEQRES and ATOM records:

>d4enwc2 c.23.16.0 (C:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d4enwc2:

• d4enwc2 first appeared in SCOPe 2.03
  
• d4enwc2 appears in SCOPe 2.05
  
• d4enwc2 appears in the current release, SCOPe 2.08