Lineage for d4enub2 (4enu B:598-753)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358810Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1358811Protein automated matches [190197] (10 species)
    not a true protein
  7. 1358828Species Escherichia coli [TaxId:83333] [226043] (12 PDB entries)
  8. 1358850Domain d4enub2: 4enu B:598-753 [220732]
    Other proteins in same PDB: d4enua1, d4enub1, d4enuc1, d4enud1
    automated match to d1p80a1
    complexed with hdd

Details for d4enub2

PDB Entry: 4enu (more details), 1.7 Å

PDB Description: Structure of the S234D variant of E. coli KatE
PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d4enub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enub2 c.23.16.0 (B:598-753) automated matches {Escherichia coli [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d4enub2:

Click to download the PDB-style file with coordinates for d4enub2.
(The format of our PDB-style files is described here.)

Timeline for d4enub2: