Lineage for d4edza1 (4edz A:2-75)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370432Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)
  8. 1370524Domain d4edza1: 4edz A:2-75 [220426]
    Other proteins in same PDB: d4edza2, d4edzb2, d4edzc2, d4edzd2
    automated match to d1pd212
    complexed with 0o5, gsh, mg

Details for d4edza1

PDB Entry: 4edz (more details), 2 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4edza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edza1 c.47.1.0 (A:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d4edza1:

Click to download the PDB-style file with coordinates for d4edza1.
(The format of our PDB-style files is described here.)

Timeline for d4edza1: