SCOPe 2.07: Domain d4ecib2: 4eci B:82-202

Lineage for d4ecib2 (4eci B:82-202)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:388272] [226355] (3 PDB entries)

8. Domain d4ecib2: 4eci B:82-202 [220417]
   Other proteins in same PDB: d4ecia1, d4ecia3, d4ecib1, d4ecib3
   automated match to d1k0db1
   complexed with act

Details for d4ecib2

PDB Entry: 4eci, 1.8 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with acetate

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4ecib2:

Sequence; same for both SEQRES and ATOM records:

>d4ecib2 a.45.1.0 (B:82-202) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld
grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp
r

Timeline for d4ecib2:

• d4ecib2 first appeared in SCOPe 2.03
  
• d4ecib2 appears in SCOPe 2.06
  
• d4ecib2 appears in the current release, SCOPe 2.08