![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
![]() | Domain d4ec0a2: 4ec0 A:76-199 [220411] Other proteins in same PDB: d4ec0a1, d4ec0b1, d4ec0b3 automated match to d1pd211 complexed with 7pq, gsh, mg |
PDB Entry: 4ec0 (more details), 1.85 Å
SCOPe Domain Sequences for d4ec0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ec0a2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d4ec0a2: