Lineage for d1c8pa_ (1c8p A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366662Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 366663Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries)
  8. 366673Domain d1c8pa_: 1c8p A: [22040]
    domain 4, the ligand-binding domain

Details for d1c8pa_

PDB Entry: 1c8p (more details)

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors

SCOP Domain Sequences for d1c8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8pa_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
malpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOP Domain Coordinates for d1c8pa_:

Click to download the PDB-style file with coordinates for d1c8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1c8pa_: