Lineage for d1c8pa_ (1c8p A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160938Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
  7. 160939Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries)
  8. 160949Domain d1c8pa_: 1c8p A: [22040]

Details for d1c8pa_

PDB Entry: 1c8p (more details)

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors

SCOP Domain Sequences for d1c8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8pa_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
malpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOP Domain Coordinates for d1c8pa_:

Click to download the PDB-style file with coordinates for d1c8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1c8pa_: