Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) |
Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries) |
Domain d1c8pa_: 1c8p A: [22040] |
PDB Entry: 1c8p (more details)
SCOP Domain Sequences for d1c8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8pa_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)} miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs malpalepstrywarvrvrtsrtgyngiwsewsearswdtes
Timeline for d1c8pa_: