Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries) |
Domain d4e8ha2: 4e8h A:90-215 [220369] Other proteins in same PDB: d4e8ha1, d4e8ha3, d4e8hb1, d4e8hb3, d4e8hc1, d4e8hc3, d4e8hd1, d4e8hd3 automated match to d1r5aa1 complexed with gsh |
PDB Entry: 4e8h (more details), 2.12 Å
SCOPe Domain Sequences for d4e8ha2:
Sequence, based on SEQRES records: (download)
>d4e8ha2 a.45.1.0 (A:90-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} knprqraiidqrlnfdlgtlylrylnlytpilfrgeaydqekadkfdealgwlntfldgr pfvagenmtvaditivvtitnidafgydfssheniakwfertkkmlepygydeidvtgak mlasfl
>d4e8ha2 a.45.1.0 (A:90-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} knprqraiidqrlnfdlgtlylrylnlytpilfraydqekadkfdealgwlntfldgrpf vagenmtvaditivvtitnidafgydfssheniakwfertkkmlepygydeidvtgakml asfl
Timeline for d4e8ha2: