Lineage for d4e8ed2 (4e8e D:90-215)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327357Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
  8. 2327375Domain d4e8ed2: 4e8e D:90-215 [220367]
    Other proteins in same PDB: d4e8ea1, d4e8ea3, d4e8eb1, d4e8eb3, d4e8ec1, d4e8ec3, d4e8ed1, d4e8ed3
    automated match to d1r5aa1

Details for d4e8ed2

PDB Entry: 4e8e (more details), 2.51 Å

PDB Description: Structural characterization of Bombyx mori glutathione transferase BmGSTD1
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d4e8ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8ed2 a.45.1.0 (D:90-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
knprqraiidqrlnfdlgtlylrylnlytpilfrgeaydqekadkfdealgwlntfldgr
pfvagenmtvaditivvtitnidafgydfssheniakwfertkkmlepygydeidvtgak
mlasfl

SCOPe Domain Coordinates for d4e8ed2:

Click to download the PDB-style file with coordinates for d4e8ed2.
(The format of our PDB-style files is described here.)

Timeline for d4e8ed2: