Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries) |
Domain d4e8ed2: 4e8e D:90-215 [220367] Other proteins in same PDB: d4e8ea1, d4e8ea3, d4e8eb1, d4e8eb3, d4e8ec1, d4e8ec3, d4e8ed1, d4e8ed3 automated match to d1r5aa1 |
PDB Entry: 4e8e (more details), 2.51 Å
SCOPe Domain Sequences for d4e8ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8ed2 a.45.1.0 (D:90-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} knprqraiidqrlnfdlgtlylrylnlytpilfrgeaydqekadkfdealgwlntfldgr pfvagenmtvaditivvtitnidafgydfssheniakwfertkkmlepygydeidvtgak mlasfl
Timeline for d4e8ed2: