Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4e42d2: 4e42 D:111-238 [220271] Other proteins in same PDB: d4e42a1, d4e42b1, d4e42c1, d4e42d1 automated match to d2esve2 complexed with cl, na, no3; mutant |
PDB Entry: 4e42 (more details), 2.7 Å
SCOPe Domain Sequences for d4e42d2:
Sequence, based on SEQRES records: (download)
>d4e42d2 b.1.1.2 (D:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
>d4e42d2 b.1.1.2 (D:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw gra
Timeline for d4e42d2: