Lineage for d4e42d2 (4e42 D:111-238)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362118Domain d4e42d2: 4e42 D:111-238 [220271]
    Other proteins in same PDB: d4e42a1, d4e42b1, d4e42c1, d4e42d1
    automated match to d2esve2
    complexed with cl, na, no3; mutant

Details for d4e42d2

PDB Entry: 4e42 (more details), 2.7 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (D:) T cell receptor G4 beta chain

SCOPe Domain Sequences for d4e42d2:

Sequence, based on SEQRES records: (download)

>d4e42d2 b.1.1.2 (D:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Sequence, based on observed residues (ATOM records): (download)

>d4e42d2 b.1.1.2 (D:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
gra

SCOPe Domain Coordinates for d4e42d2:

Click to download the PDB-style file with coordinates for d4e42d2.
(The format of our PDB-style files is described here.)

Timeline for d4e42d2: