Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (18 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226353] (2 PDB entries) |
Domain d4e2se_: 4e2s E: [220213] automated match to d1sfna_ complexed with mn, ugy |
PDB Entry: 4e2s (more details), 2.59 Å
SCOPe Domain Sequences for d4e2se_:
Sequence, based on SEQRES records: (download)
>d4e2se_ b.82.1.0 (E:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat gshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyaylppnfh hsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydf nihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwya algktrsryllykdvnrnpl
>d4e2se_ b.82.1.0 (E:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal gktrsryllykdvnrnpl
Timeline for d4e2se_: