Lineage for d1eerc2 (1eer C:117-220)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550857Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 550858Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 550862Domain d1eerc2: 1eer C:117-220 [22014]
    Other proteins in same PDB: d1eera_
    mutant

Details for d1eerc2

PDB Entry: 1eer (more details), 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms

SCOP Domain Sequences for d1eerc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eerc2 b.1.2.1 (C:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvsllt

SCOP Domain Coordinates for d1eerc2:

Click to download the PDB-style file with coordinates for d1eerc2.
(The format of our PDB-style files is described here.)

Timeline for d1eerc2: