Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Vibrio vulnificus [TaxId:216895] [226332] (1 PDB entry) |
Domain d4e0ba1: 4e0b A:1-145 [220127] Other proteins in same PDB: d4e0ba2, d4e0ba3, d4e0bb2, d4e0bb3, d4e0bc2, d4e0bc3, d4e0bd2, d4e0bd3 automated match to d2cmda1 complexed with act |
PDB Entry: 4e0b (more details), 2.17 Å
SCOPe Domain Sequences for d4e0ba1:
Sequence, based on SEQRES records: (download)
>d4e0ba1 c.2.1.0 (A:1-145) automated matches {Vibrio vulnificus [TaxId: 216895]} mkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgyag edptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigiitnp vnttvpiaaevlkkagvydkrklfg
>d4e0ba1 c.2.1.0 (A:1-145) automated matches {Vibrio vulnificus [TaxId: 216895]} mkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgyag edptpalegadvvlisagvaradlfnvnagivkslaeriavvcpnacigiitnpvnttvp iaaevlkkagvydkrklfg
Timeline for d4e0ba1: