Lineage for d4drxb2 (4drx B:246-441)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566578Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)
  8. 2566580Domain d4drxb2: 4drx B:246-441 [219982]
    Other proteins in same PDB: d4drxa1, d4drxb1, d4drxc1, d4drxd1, d4drxe_, d4drxf_
    automated match to d1z2bb2
    complexed with gtp, mg

Details for d4drxb2

PDB Entry: 4drx (more details), 2.22 Å

PDB Description: GTP-Tubulin in complex with a DARPIN
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4drxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4drxb2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d4drxb2:

Click to download the PDB-style file with coordinates for d4drxb2.
(The format of our PDB-style files is described here.)

Timeline for d4drxb2: