SCOPe 2.07: Domain d4dpgd2: 4dpg D:222-575

Lineage for d4dpgd2 (4dpg D:222-575)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)

8. Domain d4dpgd2: 4dpg D:222-575 [219912]
   Other proteins in same PDB: d4dpga1, d4dpgb1, d4dpgc1, d4dpgd1, d4dpge1, d4dpgf1, d4dpgg1, d4dpgh1
   automated match to d1bbua2
   protein/RNA complex; complexed with ala, apc, lys, mg

Details for d4dpgd2

PDB Entry: 4dpg, 2.84 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex i

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4dpgd2:

Sequence; same for both SEQRES and ATOM records:

>d4dpgd2 d.104.1.0 (D:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

Timeline for d4dpgd2:

• d4dpgd2 first appeared in SCOPe 2.03
  
• d4dpgd2 appears in SCOPe 2.06
  
• d4dpgd2 appears in the current release, SCOPe 2.08