SCOPe 2.03: Domain d4dmna_: 4dmn A:

Lineage for d4dmna_ (4dmn A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [197015] (3 PDB entries)

8. Domain d4dmna_: 4dmn A: [219865]
   automated match to d4gw6a_
   complexed with 0l9, ars, so4

Details for d4dmna_

PDB Entry: 4dmn, 2.45 Å

PDB Description: hiv-1 integrase catalytical core domain

PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d4dmna_:

Sequence, based on SEQRES records:

>d4dmna_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkt
avqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d4dmna_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihn
kkrkggiggysagerivdiiatdiq

Timeline for d4dmna_:

• d4dmna_ is new in SCOPe 2.03-stable
  
• d4dmna_ appears in SCOPe 2.04
  
• d4dmna_ appears in the current release, SCOPe 2.08