Lineage for d4dilb1 (4dil B:1-250)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603336Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 2603359Protein automated matches [227097] (3 species)
    not a true protein
  7. 2603364Species Thermotoga maritima [TaxId:2336] [226498] (2 PDB entries)
  8. 2603368Domain d4dilb1: 4dil B:1-250 [219785]
    Other proteins in same PDB: d4dila2, d4dilb2
    automated match to d1vmea2
    complexed with cl, feo; mutant

Details for d4dilb1

PDB Entry: 4dil (more details), 2 Å

PDB Description: Flavo Di-iron protein H90N mutant from Thermotoga maritima
PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d4dilb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dilb1 d.157.1.3 (B:1-250) automated matches {Thermotoga maritima [TaxId: 2336]}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdnsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd

SCOPe Domain Coordinates for d4dilb1:

Click to download the PDB-style file with coordinates for d4dilb1.
(The format of our PDB-style files is described here.)

Timeline for d4dilb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dilb2