Lineage for d1ahwf2 (1ahw F:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761856Domain d1ahwf2: 1ahw F:107-211 [21966]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwf2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
PDB Compounds: (F:) tissue factor

SCOPe Domain Sequences for d1ahwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwf2 b.1.2.1 (F:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOPe Domain Coordinates for d1ahwf2:

Click to download the PDB-style file with coordinates for d1ahwf2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwf2: