![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) ![]() |
![]() | Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
![]() | Protein Dihydropteroate synthetase [51719] (5 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries) Uniprot Q81VW8 |
![]() | Domain d4daia_: 4dai A: [219643] automated match to d1tx2a_ complexed with 0j5, so4 |
PDB Entry: 4dai (more details), 2.5 Å
SCOPe Domain Sequences for d4daia_:
Sequence, based on SEQRES records: (download)
>d4daia_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat vclgiekgcefvrvhdvkemsrmakmmdamigk
>d4daia_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid igsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfakt peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef vrvhdvkemsrmakmmdamigk
Timeline for d4daia_: