Lineage for d4da0a_ (4da0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496452Species Bacillus subtilis [TaxId:1423] [193503] (14 PDB entries)
  8. 2496475Domain d4da0a_: 4da0 A: [219631]
    automated match to d4d8vb_
    complexed with cl, gng

Details for d4da0a_

PDB Entry: 4da0 (more details), 2.95 Å

PDB Description: Crystal structure of the hexameric purine nucleoside phosphorylase from Bacillus subtilis in complex with 2'-deoxyguanosine
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4da0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4da0a_ c.56.2.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
svhigaekgqiadtvllpgdplrakfiaetylenvecynevrgmygftgtykgkkisvqg
tgmgvpsisiyvneliqsydvqnlirvgscgairkdvkvrdvilamtsstdsqmnrvafg
svdfapcadfellknaydaakdkgvpvtvgsvftadqfynddsqieklakygvlgvemet
talytlaakhgrkalsiltvsdhvltgeettaeerqttfhdmidvalhsv

SCOPe Domain Coordinates for d4da0a_:

Click to download the PDB-style file with coordinates for d4da0a_.
(The format of our PDB-style files is described here.)

Timeline for d4da0a_: