Lineage for d4d8yb1 (4d8y B:1-232)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496452Species Bacillus subtilis [TaxId:1423] [193503] (14 PDB entries)
  8. 2496454Domain d4d8yb1: 4d8y B:1-232 [219585]
    Other proteins in same PDB: d4d8ya2, d4d8yb2, d4d8yc2, d4d8yd2, d4d8ye2, d4d8yf2
    automated match to d4d8vb_
    complexed with gol, so4

Details for d4d8yb1

PDB Entry: 4d8y (more details), 1.61 Å

PDB Description: Crystal structure of the hexameric purine nucleoside phosphorylase from Bacillus subtilis in space group P212121 at pH 5.6
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4d8yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8yb1 c.56.2.1 (B:1-232) automated matches {Bacillus subtilis [TaxId: 1423]}
msvhigaekgqiadtvllpgdplrakfiaetylenvecynevrgmygftgtykgkkisvq
gtgmgvpsisiyvneliqsydvqnlirvgscgairkdvkvrdvilamtsstdsqmnrvaf
gsvdfapcadfellknaydaakdkgvpvtvgsvftadqfynddsqieklakygvlgveme
ttalytlaakhgrkalsiltvsdhvltgeettaeerqttfhdmidvalhsvs

SCOPe Domain Coordinates for d4d8yb1:

Click to download the PDB-style file with coordinates for d4d8yb1.
(The format of our PDB-style files is described here.)

Timeline for d4d8yb1: