Lineage for d1ahk__ (1ahk -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Major mite allergen [49256] (2 species) 
Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (2 PDB entries) 
Domain d1ahk__: 1ahk - [21945]
Details for d1ahk__
PDB Entry: 1ahk (more details)
PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
SCOP Domain Sequences for d1ahk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahk__ b.1.1.5 (-) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird
SCOP Domain Coordinates for d1ahk__:
Click to download the PDB-style file with coordinates for d1ahk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ahk__:
- d1ahk__ first appeared (with stable ids) in SCOP 1.55
- d1ahk__ appears in SCOP 1.59
- d1ahk__ appears in SCOP 1.63
- d1ahk__ appears in the current release, SCOPe 2.08, called d1ahka_
View in 3D