SCOPe 2.03: Domain d4bd0a_: 4bd0 A:

Lineage for d4bd0a_ (4bd0 A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (17 PDB entries)

8. Domain d4bd0a_: 4bd0 A: [219446]
   automated match to d4bd1a_
   complexed with bzb, so4; mutant

Details for d4bd0a_

PDB Entry: 4bd0, 1.21 Å

PDB Description: x-ray structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb)

PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d4bd0a_:

Sequence; same for both SEQRES and ATOM records:

>d4bd0a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaenrndilaaaakivthgf

Timeline for d4bd0a_:

• d4bd0a_ is new in SCOPe 2.03-stable
  
• d4bd0a_ appears in SCOPe 2.04
  
• d4bd0a_ appears in the current release, SCOPe 2.08