Lineage for d4bcnd1 (4bcn D:177-308)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331672Protein automated matches [227027] (3 species)
    not a true protein
  7. 2331702Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2331705Domain d4bcnd1: 4bcn D:177-308 [219430]
    Other proteins in same PDB: d4bcna1, d4bcna2, d4bcnc1, d4bcnc2
    automated match to d2cchb1
    complexed with so4, t9n

Details for d4bcnd1

PDB Entry: 4bcn (more details), 2.1 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4bcnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcnd1 a.74.1.1 (D:177-308) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaa

SCOPe Domain Coordinates for d4bcnd1:

Click to download the PDB-style file with coordinates for d4bcnd1.
(The format of our PDB-style files is described here.)

Timeline for d4bcnd1: