Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.1: PYP-like [55786] (2 proteins) |
Protein Photoactive yellow protein, PYP [55787] (1 species) |
Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (61 PDB entries) Uniprot P16113 |
Domain d4bbva_: 4bbv A: [219410] automated match to d1nwza_ complexed with hc4 |
PDB Entry: 4bbv (more details), 1.6 Å
SCOPe Domain Sequences for d4bbva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bbva_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]} mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv fvkrv
Timeline for d4bbva_: