Lineage for d4bb5d_ (4bb5 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451497Species Human (Homo sapiens) [TaxId:9606] [186828] (33 PDB entries)
  8. 2451511Domain d4bb5d_: 4bb5 D: [219402]
    automated match to d3dwfc1
    complexed with hd2, nap

Details for d4bb5d_

PDB Entry: 4bb5 (more details), 2.2 Å

PDB Description: Free-Wilson and Structural Approaches to Co-optimising Human and Rodent Isoform Potency for 11b-Hydroxysteroid Dehydrogenase Type 1 11b-HSD1 Inhibitors
PDB Compounds: (D:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4bb5d_:

Sequence, based on SEQRES records: (download)

>d4bb5d_ c.2.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvayplvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwtt
llirnpsrkileelystsynmdrfi

Sequence, based on observed residues (ATOM records): (download)

>d4bb5d_ c.2.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvayplvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgmqaapkeecaleiikggalrqeevyydssrwttlli
rnpsrkileelystsynmdrfi

SCOPe Domain Coordinates for d4bb5d_:

Click to download the PDB-style file with coordinates for d4bb5d_.
(The format of our PDB-style files is described here.)

Timeline for d4bb5d_: