Lineage for d1iknc_ (1ikn C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788965Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 788980Species Mouse (Mus musculus) [TaxId:10090] [49250] (10 PDB entries)
  8. 788984Domain d1iknc_: 1ikn C: [21928]
    Other proteins in same PDB: d1ikna1, d1ikna2, d1iknd_

Details for d1iknc_

PDB Entry: 1ikn (more details), 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex
PDB Compounds: (C:) protein (nf-kappa-b p50d subunit)

SCOP Domain Sequences for d1iknc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iknc_ b.1.18.1 (C:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev

SCOP Domain Coordinates for d1iknc_:

Click to download the PDB-style file with coordinates for d1iknc_.
(The format of our PDB-style files is described here.)

Timeline for d1iknc_: