Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins) subgroup of the larger IPT/TIG domain family |
Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49249] (2 PDB entries) |
Domain d1svcp1: 1svc P:251-353 [21924] Other proteins in same PDB: d1svcp2 protein/DNA complex; mutant |
PDB Entry: 1svc (more details), 2.6 Å
SCOP Domain Sequences for d1svcp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svcp1 b.1.18.1 (P:251-353) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)} lkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqf aivfktpkykdinitkpasvfvqlrrksdletsepkpflyype
Timeline for d1svcp1: