Lineage for d4azma1 (4azm A:1-134)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414734Protein automated matches [190295] (7 species)
    not a true protein
  7. 2414754Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 2414938Domain d4azma1: 4azm A:1-134 [219223]
    Other proteins in same PDB: d4azma2
    automated match to d1b56a_
    complexed with gol, t4b

Details for d4azma1

PDB Entry: 4azm (more details), 2.75 Å

PDB Description: human epidermal fatty acid-binding protein (fabp5) in complex with the inhibitor bms-309413
PDB Compounds: (A:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4azma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4azma1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestl
kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec
vmnnvtctriyekv

SCOPe Domain Coordinates for d4azma1:

Click to download the PDB-style file with coordinates for d4azma1.
(The format of our PDB-style files is described here.)

Timeline for d4azma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4azma2
View in 3D
Domains from other chains:
(mouse over for more information)
d4azmb_