SCOPe 2.07: Domain d4axhb2: 4axh B:539-660

Lineage for d4axhb2 (4axh B:539-660)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.0: automated matches [191568] (1 protein)
   not a true family

6. Protein automated matches [190987] (4 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)

8. Domain d4axhb2: 4axh B:539-660 [219194]
   Other proteins in same PDB: d4axha1, d4axhb1, d4axhb3
   automated match to d2cfua1
   complexed with so4, zn

Details for d4axhb2

PDB Entry: 4axh, 2.7 Å

PDB Description: structure and mechanism of the first inverting alkylsulfatase specific for secondary alkylsulfatases

PDB Compounds: (B:) sec-alkylsulfatase

SCOPe Domain Sequences for d4axhb2:

Sequence; same for both SEQRES and ATOM records:

>d4axhb2 d.106.1.0 (B:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
ve

Timeline for d4axhb2:

• d4axhb2 first appeared in SCOPe 2.03
  
• d4axhb2 appears in SCOPe 2.06
  
• d4axhb2 appears in the current release, SCOPe 2.08