SCOPe 2.04: Domain d4avxa1: 4avx A:6-147

Lineage for d4avxa1 (4avx A:6-147)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189251] (6 PDB entries)

8. Domain d4avxa1: 4avx A:6-147 [219173]
   Other proteins in same PDB: d4avxa2
   automated match to d1dvpa1
   complexed with edo, itp, zn

Details for d4avxa1

PDB Entry: 4avx, 1.68 Å

PDB Description: hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution

PDB Compounds: (A:) hepatocyte growth factor-regulated tyrosine kinase substrate

SCOPe Domain Sequences for d4avxa1:

Sequence; same for both SEQRES and ATOM records:

>d4avxa1 a.118.9.0 (A:6-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtferlldkatsqllletdwesilqicdlirqgdtqakyavnsikkkvndknphvalyal
evmesvvkncgqtvhdevankqtmeelkdllkrqvevnvrnkilyliqawahafrnepky
kvvqdtyqimkveghvfpefke

Timeline for d4avxa1:

• d4avxa1 first appeared in SCOPe 2.03
  
• d4avxa1 appears in SCOPe 2.05
  
• d4avxa1 appears in the current release, SCOPe 2.08