Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (4 species) not a true protein |
Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries) |
Domain d4afhe_: 4afh E: [218837] automated match to d4b5dc_ complexed with l0b |
PDB Entry: 4afh (more details), 1.88 Å
SCOPe Domain Sequences for d4afhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4afhe_ b.96.1.0 (E:) automated matches {Capitella teleta [TaxId: 283909]} nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle ilensaqrqevvypccesayvemkyllalrse
Timeline for d4afhe_:
View in 3D Domains from other chains: (mouse over for more information) d4afha_, d4afhb_, d4afhc_, d4afhd_ |