Lineage for d4afhc_ (4afh C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429729Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)
  8. 2429732Domain d4afhc_: 4afh C: [218835]
    automated match to d4b5dc_
    complexed with l0b

Details for d4afhc_

PDB Entry: 4afh (more details), 1.88 Å

PDB Description: capitella teleta achbp in complex with lobeline
PDB Compounds: (C:) achbp

SCOPe Domain Sequences for d4afhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4afhc_ b.96.1.0 (C:) automated matches {Capitella teleta [TaxId: 283909]}
snglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigt
fkaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivf
sngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsl
eilensaqrqevvypccesayvemkyllalrse

SCOPe Domain Coordinates for d4afhc_:

Click to download the PDB-style file with coordinates for d4afhc_.
(The format of our PDB-style files is described here.)

Timeline for d4afhc_: