![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (5 species) not a true protein |
![]() | Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries) |
![]() | Domain d4afhc_: 4afh C: [218835] automated match to d4b5dc_ complexed with l0b |
PDB Entry: 4afh (more details), 1.88 Å
SCOPe Domain Sequences for d4afhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4afhc_ b.96.1.0 (C:) automated matches {Capitella teleta [TaxId: 283909]} snglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigt fkaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivf sngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsl eilensaqrqevvypccesayvemkyllalrse
Timeline for d4afhc_:
![]() Domains from other chains: (mouse over for more information) d4afha_, d4afhb_, d4afhd_, d4afhe_ |