Lineage for d4aana1 (4aan A:24-188)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257759Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1257760Protein automated matches [190453] (16 species)
    not a true protein
  7. 1257768Species Geobacter sulfurreducens [TaxId:243231] [226497] (4 PDB entries)
  8. 1257769Domain d4aana1: 4aan A:24-188 [218756]
    automated match to d1nmla1
    complexed with bu3, ca, hec

Details for d4aana1

PDB Entry: 4aan (more details), 1.22 Å

PDB Description: MacA wild-type fully reduced
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aana1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aana1 a.3.1.0 (A:24-188) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dvmkraqglfkpipakppvmkdnpaspsrvelgrmlffdprlsashliscntchnvglgg
tdiletsighgwqkgprnsptvlnavyniaqfwdgraedlaaqakgpvqasvemnnkpen
lvatlksipgypplfrkafpgqgdpvtfdnvakaievfeatlvtp

SCOPe Domain Coordinates for d4aana1:

Click to download the PDB-style file with coordinates for d4aana1.
(The format of our PDB-style files is described here.)

Timeline for d4aana1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aana2