Lineage for d4aala2 (4aal A:189-346)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1477453Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1477454Protein automated matches [190453] (16 species)
    not a true protein
  7. 1477462Species Geobacter sulfurreducens [TaxId:243231] [226497] (4 PDB entries)
  8. 1477466Domain d4aala2: 4aal A:189-346 [218751]
    automated match to d1nmla2
    complexed with act, ca, eoh, hec, po4

Details for d4aala2

PDB Entry: 4aal (more details), 1.84 Å

PDB Description: maca wild-type oxidized
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aala2:

Sequence, based on SEQRES records: (download)

>d4aala2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

Sequence, based on observed residues (ATOM records): (download)

>d4aala2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvddt
grykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadad
kivtflntltgaqpkvmhpvlppnsddtprpvsn

SCOPe Domain Coordinates for d4aala2:

Click to download the PDB-style file with coordinates for d4aala2.
(The format of our PDB-style files is described here.)

Timeline for d4aala2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aala1