Lineage for d4a9nb_ (4a9n B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267143Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1267144Protein automated matches [190615] (4 species)
    not a true protein
  7. 1267148Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)
  8. 1267252Domain d4a9nb_: 4a9n B: [218739]
    automated match to d3zyub_
    complexed with a9n, dms, edo, so4

Details for d4a9nb_

PDB Entry: 4a9n (more details), 1.85 Å

PDB Description: n-terminal bromodomain of human brd2 with n-cyclopropyl-5-(3,5- dimethyl-1,2-oxazol-4-yl)-2-methylbenzene-1-sulfonamide
PDB Compounds: (B:) bromodomain containing 2

SCOPe Domain Sequences for d4a9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a9nb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrle
nnyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqe

SCOPe Domain Coordinates for d4a9nb_:

Click to download the PDB-style file with coordinates for d4a9nb_.
(The format of our PDB-style files is described here.)

Timeline for d4a9nb_: