SCOPe 2.04: Domain d3zyqa2: 3zyq A:148-221

Lineage for d3zyqa2 (3zyq A:148-221)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (19 PDB entries)

8. Domain d3zyqa2: 3zyq A:148-221 [218592]
   Other proteins in same PDB: d3zyqa1
   automated match to d1dvpa2
   complexed with edo, so4, zn

Details for d3zyqa2

PDB Entry: 3zyq, 1.48 Å

PDB Description: crystal structure of the tandem vhs and fyve domains of hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) at 1.48 a resolution

PDB Compounds: (A:) hepatocyte growth factor-regulated tyrosine kinase substrate

SCOPe Domain Sequences for d3zyqa2:

Sequence; same for both SEQRES and ATOM records:

>d3zyqa2 g.50.1.0 (A:148-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdamfaaerapdwvdaeechrcrvqfgvmtrkhhcracgqifcgkcsskystipkfgiek
evrvcepcyeqlnr

Timeline for d3zyqa2:

• d3zyqa2 first appeared in SCOPe 2.03
  
• d3zyqa2 appears in SCOPe 2.05
  
• d3zyqa2 appears in the current release, SCOPe 2.08