Lineage for d3zuni_ (3zun I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378726Protein automated matches [193392] (1 species)
    not a true protein
  7. 2378727Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2378742Domain d3zuni_: 3zun I: [218524]
    Other proteins in same PDB: d3zuna_, d3zunb_, d3zund_, d3zune_, d3zung_, d3zunh_, d3zunj_, d3zunk_
    automated match to d4awjf_
    complexed with gol, zun

Details for d3zuni_

PDB Entry: 3zun (more details), 2.5 Å

PDB Description: pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d3zuni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zuni_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

SCOPe Domain Coordinates for d3zuni_:

Click to download the PDB-style file with coordinates for d3zuni_.
(The format of our PDB-style files is described here.)

Timeline for d3zuni_: