SCOPe 2.08: Domain d3zpcb2: 3zpc B:151-358

Lineage for d3zpcb2 (3zpc B:151-358)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [226628] (2 PDB entries)

8. Domain d3zpcb2: 3zpc B:151-358 [218394]
   Other proteins in same PDB: d3zpca1, d3zpcb1
   automated match to d2hxva1
   complexed with act, po4, zn

Details for d3zpcb2

PDB Entry: 3zpc, 2.2 Å

PDB Description: acinetobacter baumannii ribd, form 1

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3zpcb2:

Sequence; same for both SEQRES and ATOM records:

>d3zpcb2 c.71.1.0 (B:151-358) automated matches {Acinetobacter baumannii [TaxId: 470]}
pyvrlkvassldgrtamasgeskwitgsaarqdvqhwraisgavitgidtviaddcqlnv
rslhnidietvaqpkrvildrrgrlpltakilenpetvmvmgpyrqeladlgviqleiqp
lktllqtlskqyqiydvlieagatlssaflqeglidemisyvaptllgqsaramfnadfe
ymaqqlrfklldviqldqdirlrliptq

Timeline for d3zpcb2:

• d3zpcb2 first appeared in SCOPe 2.03
  
• d3zpcb2 appears in SCOPe 2.07