Lineage for d1cxka1 (1cxk A:497-583)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (25 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) 
Domain d1cxka1: 1cxk A:497-583 [21835]
Other proteins in same PDB: d1cxka2, d1cxka3, d1cxka4
Details for d1cxka1
PDB Entry: 1cxk (more details), 2.09 Å
PDB Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
SCOP Domain Sequences for d1cxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxka1 b.1.1.5 (A:497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls
SCOP Domain Coordinates for d1cxka1:
Click to download the PDB-style file with coordinates for d1cxka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxka1:
- d1cxka1 first appeared (with stable ids) in SCOP 1.55
- d1cxka1 appears in SCOP 1.57
- d1cxka1 appears in SCOP 1.61
- d1cxka1 appears in the current release, SCOPe 2.08
View in 3D
