SCOP 1.63: Domain d1cxla1: 1cxl A:497-583

Lineage for d1cxla1 (1cxl A:497-583)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d1cxla1: 1cxl A:497-583 [21829]
   Other proteins in same PDB: d1cxla2, d1cxla3, d1cxla4
   complexed with ca, g4d, glc, glf, mpd; mutant

Details for d1cxla1

PDB Entry: 1cxl, 1.81 Å

PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q

SCOP Domain Sequences for d1cxla1:

Sequence; same for both SEQRES and ATOM records:

>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

Timeline for d1cxla1:

• d1cxla1 first appeared (with stable ids) in SCOP 1.55
  
• d1cxla1 appears in SCOP 1.61
  
• d1cxla1 appears in SCOP 1.65
  
• d1cxla1 appears in the current release, SCOPe 2.08