Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries) |
Domain d3vwxa1: 3vwx A:3-87 [218132] Other proteins in same PDB: d3vwxa2, d3vwxb2, d3vwxc2, d3vwxd2 automated match to d1r5aa2 complexed with gsh |
PDB Entry: 3vwx (more details), 1.8 Å
SCOPe Domain Sequences for d3vwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vwxa1 c.47.1.0 (A:3-87) automated matches {House fly (Musca domestica) [TaxId: 7370]} klvlygidpsppvraclltlkalnlpfeykvvnlfakehlseeylkknpqhtvptleedg hliwdshaimaylvskygkddslyp
Timeline for d3vwxa1: