Lineage for d1qbba1 (1qbb A:781-885)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765193Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
    rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases
  7. 2765194Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 2765198Domain d1qbba1: 1qbb A:781-885 [21811]
    Other proteins in same PDB: d1qbba2, d1qbba3, d1qbba4
    complexed with so4
    has additional insertions and/or extensions that are not grouped together

Details for d1qbba1

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)
PDB Compounds: (A:) chitobiase

SCOPe Domain Sequences for d1qbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbba1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens [TaxId: 615]}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOPe Domain Coordinates for d1qbba1:

Click to download the PDB-style file with coordinates for d1qbba1.
(The format of our PDB-style files is described here.)

Timeline for d1qbba1: